PANK4 Antibody

Name PANK4 Antibody
Supplier Novus Biologicals
Catalog NBP1-55012
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PANK4(pantothenate kinase 4) The peptide sequence was selected from the N terminal of PANK4. Peptide sequence MAECGASGSGSSGDSLDKSITLPPDEIFRNLENAKRFAIDIGGSLTKLAY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PANK4
Conjugate Unconjugated
Supplier Page Shop

Product images