AMD1 Antibody

Name AMD1 Antibody
Supplier Novus Biologicals
Catalog NBP1-54975
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to AMD1(adenosylmethionine decarboxylase 1) The peptide sequence was selected from the N terminal of AMD1. Peptide sequence MGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene AMD1
Conjugate Unconjugated
Supplier Page Shop

Product images