PIN/DLC8 Antibody

Name PIN/DLC8 Antibody
Supplier Novus Biologicals
Catalog NBP1-54970
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DYNLL1(dynein, light chain, LC8-type 1) The peptide sequence was selected from the middle region of DYNLL1. Peptide sequence EKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAIL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DYNLL1
Conjugate Unconjugated
Supplier Page Shop

Product images