AGXT2L1 Antibody

Name AGXT2L1 Antibody
Supplier Novus Biologicals
Catalog NBP1-54965
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to AGXT2L1(alanine-glyoxylate aminotransferase 2-like 1) The peptide sequence was selected from the middle region of AGXT2L1. Peptide sequence KRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDRILTVLEEAMGTKT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ETNPPL
Conjugate Unconjugated
Supplier Page Shop

Product images