Name | IMPA2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-54964 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Bovine, Dog, Horse, Rabbit |
Antigen | Synthetic peptides corresponding to IMPA2(inositol(myo)-1(or 4)-monophosphatase 2) The peptide sequence was selected from the middle region of IMPA2. Peptide sequence RGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLH. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | IMPA2 |
Supplier Page | Shop |