IMPA2 Antibody

Name IMPA2 Antibody
Supplier Novus Biologicals
Catalog NBP1-54964
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Bovine, Dog, Horse, Rabbit
Antigen Synthetic peptides corresponding to IMPA2(inositol(myo)-1(or 4)-monophosphatase 2) The peptide sequence was selected from the middle region of IMPA2. Peptide sequence RGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLH.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene IMPA2
Supplier Page Shop

Product images