CGR19 Antibody

Name CGR19 Antibody
Supplier Novus Biologicals
Catalog NBP1-55026
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CGRRF1(cell growth regulator with ring finger domain 1) The peptide sequence was selected from the middle region of CGRRF1. Peptide sequence KKDSKEEIYCQLPRDTKIEDFGTVPRSRYPLVALLTLADEDDREIYDIIS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CGRRF1
Conjugate Unconjugated
Supplier Page Shop

Product images