SgK071 Antibody

Name SgK071 Antibody
Supplier Novus Biologicals
Catalog NBP1-55182
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SgK071 The peptide sequence was selected from the C terminal of SgK071. Peptide sequence AFKVVVQEEGGSGLSLIKETYQLHRDDPEVVENVGMLLVHLASYEEILPE.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene STKLD1
Conjugate Unconjugated
Supplier Page Shop

Product images