METTL2B Antibody

Name METTL2B Antibody
Supplier Novus Biologicals
Catalog NBP1-55229
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to METTL2B(methyltransferase like 2B) The peptide sequence was selected from the N terminal of METTL2B. Peptide sequence INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene METTL2B
Conjugate Unconjugated
Supplier Page Shop

Product images