Name | MBOAT1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55258 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to MBOAT1(membrane bound O-acyltransferase domain containing 1) The peptide sequence was selected from the N terminal of MBOAT1. Peptide sequence AAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFR. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | MBOAT1 |
Conjugate | Unconjugated |
Supplier Page | Shop |