Name | EEF1A2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55245 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to EEF1A2(eukaryotic translation elongation factor 1 alpha 2) The peptide sequence was selected from the middle region of EEF1A2. Peptide sequence VIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKP. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | EEF1A2 |
Conjugate | Unconjugated |
Supplier Page | Shop |