Name | RPS15A Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55208 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Goat, Rabbit, Zebrafish |
Antigen | Synthetic peptides corresponding to RPS15A(ribosomal protein S15a) The peptide sequence was selected from the middle region of RPS15A. Peptide sequence KCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKH. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | RPS15A |
Supplier Page | Shop |