RPS15 Antibody
| Name | RPS15 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55205 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RPS15(ribosomal protein S15) The peptide sequence was selected from the middle region of RPS15. Peptide sequence GVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RPS15 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: RPS15 Antibody [NBP1-55205] - Sample Tissue: Human Hela Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7278_RPS15-Antibody-Western-Blot-NBP1-55205-img0004.jpg)
![Western Blot: RPS15 Antibody [NBP1-55205] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7279_RPS15%2520Antibody-Western%2520Blot-NBP1-55205-img0005.jpg)