Name | RPS15 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55205 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to RPS15(ribosomal protein S15) The peptide sequence was selected from the middle region of RPS15. Peptide sequence GVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPL. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | RPS15 |
Conjugate | Unconjugated |
Supplier Page | Shop |