Name | RPL37A Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55204 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to RPL37A(ribosomal protein L37a) The peptide sequence was selected from the middle region of RPL37A. Peptide sequence CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | RPL37A |
Conjugate | Unconjugated |
Supplier Page | Shop |