KLRAQ1 Antibody
| Name | KLRAQ1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56287 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CCDC128(coiled-coil domain containing 128) The peptide sequence was selected from the N terminal of CCDC128. Peptide sequence KRVELLQDELALSEPRGKKNKKSGESSSQLSQEQKSVFDEDLQKKIEENE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PPP1R21 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: KLRAQ1 Antibody [NBP1-56287] - Human Muscle lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16830_KLRAQ1-Antibody-Western-Blot-NBP1-56287-img0003.jpg)
Western Blot: KLRAQ1 Antibody [NBP1-56287] - Human Muscle lysate, concentration 0.2-1 ug/ml.