TBC1D24 Antibody
| Name | TBC1D24 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55504 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TBC1D24(TBC1 domain family, member 24) The peptide sequence was selected from the middle region of TBC1D24. Peptide sequence SDPADRLSPFLAARHFNLPSKTESMFMAGGSDCLIVGGGGGQALYIDGDL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TBC1D24 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: TBC1D24 Antibody [NBP1-55504] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7169_TBC1D24-Antibody-Western-Blot-NBP1-55504-img0004.jpg)
![Western Blot: TBC1D24 Antibody [NBP1-55504] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:1562500 Positive Control: Human kidney](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7170_TBC1D24%2520Antibody-Western%2520Blot-NBP1-55504-img0005.jpg)