PSG3 Antibody
| Name | PSG3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55491 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PSG3(pregnancy specific beta-1-glycoprotein 3) The peptide sequence was selected from the N terminal of PSG3. Peptide sequence VYSNASLLIQNVTREDAGSYTLHIVKRGDGTRGETGHFTFTLYLETPKPS. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | PSG3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: PSG3 Antibody [NBP1-55491] - HepG2 cell lysate, Antibody Titration: 5.0ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24182_PSG3-Antibody-Western-Blot-NBP1-55491-img0001.jpg)
![Immunohistochemistry-Paraffin: PSG3 Antibody [NBP1-55491] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24183_PSG3-Antibody-Immunohistochemistry-Paraffin-NBP1-55491-img0003.jpg)