Name | alcohol dehydrogenase 6 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56345 |
Prices | $299.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Bovine, Rabbit |
Antigen | Synthetic peptides corresponding to ADH6(alcohol dehydrogenase 6 (class V)) The peptide sequence was selected from the middle region of ADH6 (AAH39065). Peptide sequence AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | ADH6 |
Supplier Page | Shop |