alcohol dehydrogenase 6 Antibody

Name alcohol dehydrogenase 6 Antibody
Supplier Novus Biologicals
Catalog NBP1-56345
Prices $299.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Bovine, Rabbit
Antigen Synthetic peptides corresponding to ADH6(alcohol dehydrogenase 6 (class V)) The peptide sequence was selected from the middle region of ADH6 (AAH39065). Peptide sequence AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene ADH6
Supplier Page Shop

Product images