Fructosamine-3-kinase-related Antibody
| Name | Fructosamine-3-kinase-related Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56367 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to FN3KRP(fructosamine-3-kinase-related protein) The peptide sequence was selected from the N terminal of FN3KRP. Peptide sequence MDPGDPAGDPAAGERHRMGRDPLLLLQALQTLWSTRERKQLREEAWRGFA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | FN3KRP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Fructosamine-3-kinase-related Antibody [NBP1-56367] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16772_Fructosamine-3-kinase-related-Antibody-Western-Blot-NBP1-56367-img0002.jpg)
Western Blot: Fructosamine-3-kinase-related Antibody [NBP1-56367] - Jurkat cell lysate, concentration 0.2-1 ug/ml.