KANK3 Antibody

Name KANK3 Antibody
Supplier Novus Biologicals
Catalog NBP1-56366
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ANKRD47 The peptide sequence was selected from the N terminal of ANKRD47. Peptide sequence GPAQLQLVREQMAAALRRLRELEDQARTLPELQEQVRALRAEKARLLAGR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene KANK3
Conjugate Unconjugated
Supplier Page Shop

Product images