CYB5D1 Antibody

Name CYB5D1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56361
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CYB5D1(cytochrome b5 domain containing 1) The peptide sequence was selected from the middle region of CYB5D1. Peptide sequence KYEGKNLNMDFTLEENGIRDEEEEFDYLSMDGTLHTPAILLYFNDDLTEL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CYB5D1
Conjugate Unconjugated
Supplier Page Shop

Product images