DYSFIP1 Antibody

Name DYSFIP1 Antibody
Supplier Novus Biologicals
Catalog NBP1-55525
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DYSFIP1(dysferlin interacting protein 1) The peptide sequence was selected from the middle region of DYSFIP1. Peptide sequence DHIRQGDLEQVGRFIRTRKVSLATIHPSGLAALHEAVLSGNLECVKLLVK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PPP1R27
Conjugate Unconjugated
Supplier Page Shop

Product images