CLTB Antibody

Name CLTB Antibody
Supplier Novus Biologicals
Catalog NBP1-68945
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CLTB (clathrin, light chain (Lcb)) The peptide sequence was selected from the C terminal of CLTB. Peptide sequence ADIIGYVASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CLTB
Conjugate Unconjugated
Supplier Page Shop

Product images