TMCO4 Antibody

Name TMCO4 Antibody
Supplier Novus Biologicals
Catalog NBP1-68907
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TMCO4 (transmembrane and coiled-coil domains 4) The peptide sequence was selected from the C terminal of TMCO4. Peptide sequence WPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TMCO4
Conjugate Unconjugated
Supplier Page Shop

Product images