MRPL49 Antibody

Name MRPL49 Antibody
Supplier Novus Biologicals
Catalog NBP1-68932
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MRPL49 (mitochondrial ribosomal protein L49) The peptide sequence was selected from the N terminal of MRPL49. Peptide sequence ESVDEYQFVERLLPATRIPDPPKHEHYPTPSGWQPPRDPPPNLPYFVRRS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MRPL49
Conjugate Unconjugated
Supplier Page Shop

Product images