GRK7 Antibody

Name GRK7 Antibody
Supplier Novus Biologicals
Catalog NBP1-68989
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Pig, Bovine, Dog, Guinea Pig
Antigen Synthetic peptides corresponding to GRK7 (G protein-coupled receptor kinase 7) The peptide sequence was selected from the C terminal of GRK7. Peptide sequence FFKNFATGAVPIAWQEEIIETGLFEELNDPNRPTGCEEGNSSKSGVCLLL.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene GRK7
Supplier Page Shop

Product images