Name | MOSC1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-69519 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to MOSC1(MOCO sulphurase C-terminal domain containing 1) The peptide sequence was selected from the C terminal of MOSC1. Peptide sequence WDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQCDPS. |
Purity/Format | Immunogen affinity purified |
Blocking Peptide | MOSC1 Blocking Peptide |
Description | Rabbit Polyclonal |
Gene | MARC1 |
Conjugate | Unconjugated |
Supplier Page | Shop |