MOSC1 Antibody
| Name | MOSC1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69519 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MOSC1(MOCO sulphurase C-terminal domain containing 1) The peptide sequence was selected from the C terminal of MOSC1. Peptide sequence WDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQCDPS. |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MOSC1 Blocking Peptide |
| Description | Rabbit Polyclonal |
| Gene | MARC1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MOSC1 Antibody [NBP1-69519] - This Anti-MOSC1 antibody was used in Western Blot of Placenta tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16790_MOSC1%2520Antibody-Western%2520Blot-NBP1-69519-img0001.jpg)
Western Blot: MOSC1 Antibody [NBP1-69519] - This Anti-MOSC1 antibody was used in Western Blot of Placenta tissue lysate at a concentration of 1ug/ml.