LPPR2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-69329
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to LPPR2(lipid phosphate phosphatase-related protein type 2) The peptide sequence was selected from the middle region of LPPR2. Peptide sequence NYTALGCLPPSPDRPGPDRFVTDQGACAGSPSLVAAARRAFPCKDAALCA.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: LPPR2
• Conjugate: Unconjugated