ZCCHC17 Antibody

Name ZCCHC17 Antibody
Supplier Novus Biologicals
Catalog NBP1-57131
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ZCCHC17(zinc finger, CCHC domain containing 17) The peptide sequence was selected from the middle region of ZCCHC17. Peptide sequence CFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKH.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZCCHC17
Conjugate Unconjugated
Supplier Page Shop

Product images