RBM11 Antibody

Name RBM11 Antibody
Supplier Novus Biologicals
Catalog NBP1-57083
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RBM11 (RNA binding motif protein 11) The peptide sequence was selected from the middle region of RBM11. Peptide sequence SLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQTSDSDSSTDNNR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RBM11
Conjugate Unconjugated
Supplier Page Shop

Product images