CCDC146 Antibody

Name CCDC146 Antibody
Supplier Novus Biologicals
Catalog NBP1-57040
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CCDC146 (coiled-coil domain containing 146) The peptide sequence was selected from the middle region of CCDC146. Peptide sequence KEIEKEWLKVLRDEEMHALAIAEKSQEFLEADNRQLPNGVYTTAEQRPNA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CCDC146
Conjugate Unconjugated
Supplier Page Shop

Product images