OTOS Antibody

Name OTOS Antibody
Supplier Novus Biologicals
Catalog NBP1-57031
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to OTOS (otospiralin) The peptide sequence was selected from the N terminal of OTOS. Peptide sequence MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene OTOS
Conjugate Unconjugated
Supplier Page Shop

Product images