FAM78A Antibody

Name FAM78A Antibody
Supplier Novus Biologicals
Catalog NBP1-56951
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FAM78A(family with sequence similarity 78, member A) The peptide sequence was selected from the N terminal of FAM78A. Peptide sequence MPGFFCDCWPSLEIRALLYAMGCIQSIGGKARVFREGITVIDVKASIDPV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FAM78A
Conjugate Unconjugated
Supplier Page Shop

Product images