DHDH Antibody

Name DHDH Antibody
Supplier Novus Biologicals
Catalog NBP1-56950
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Pig, Bovine, Dog
Antigen Synthetic peptides corresponding to DHDH(dihydrodiol dehydrogenase (dimeric)) The peptide sequence was selected from the middle region of DHDH. Peptide sequence PCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMK.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene DHDH
Supplier Page Shop

Product images