GGTLC1 Antibody
| Name | GGTLC1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56928 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GGTLA4(gamma-glutamyltransferase-like activity 4) The peptide sequence was selected from the C terminal of GGTLA4. Peptide sequence DQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | GGTLC1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: GGTLC1 Antibody [NBP1-56928] - Antibody Titration: 5.0ug/ml Positive Control: Human kidney](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24724_GGTLC1-Antibody-Western-Blot-NBP1-56928-img0001.jpg)
Western Blot: GGTLC1 Antibody [NBP1-56928] - Antibody Titration: 5.0ug/ml Positive Control: Human kidney
![Immunohistochemistry-Paraffin: GGTLC1 Antibody [NBP1-56928] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24725_GGTLC1-Antibody-Immunohistochemistry-Paraffin-NBP1-56928-img0002.jpg)
Immunohistochemistry-Paraffin: GGTLC1 Antibody [NBP1-56928] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.