ATPAF1 Antibody

Name ATPAF1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56969
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ATPAF1 (ATP synthase mitochondrial F1 complex assembly factor 1) The peptide sequence was selected from the N terminal of ATPAF1. Peptide sequence GLGLVSPAQLRVFPVRPGSGRPEGGADSSGVGAEAELQANPFYDRYRDKI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ATPAF1
Conjugate Unconjugated
Supplier Page Shop

Product images