gamma-2 Tubulin Antibody

Name gamma-2 Tubulin Antibody
Supplier Novus Biologicals
Catalog NBP1-57013
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TUBG2 (tubulin, gamma 2) The peptide sequence was selected from the middle region of TUBG2. Peptide sequence FDKLRKRDAFLEQFRKEDMFKDNFDEMDRSREVVQELIDEYHAATQPDYI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TUBG2
Conjugate Unconjugated
Supplier Page Shop

Product images