MITD1 Antibody

Name MITD1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57006
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MITD1 (MIT, microtubule interacting and transport, domain containing 1) The peptide sequence was selected from the middle region of MITD1. Peptide sequence RAENIKKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLNETVTE
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MITD1
Conjugate Unconjugated
Supplier Page Shop

Product images