Name | p40 (p63 delta) Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57004 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Pig, Dog, Rabbit |
Antigen | Synthetic peptides corresponding to RABEPK (Rab9 effector protein with kelch motifs) The peptide sequence was selected from the N terminal of RABEPK. Peptide sequence SCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLL. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | RABEPK |
Supplier Page | Shop |