p40 (p63 delta) Antibody
| Name | p40 (p63 delta) Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57003 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Pig, Dog, Rabbit |
| Antigen | Synthetic peptides corresponding to RABEPK (Rab9 effector protein with kelch motifs) The peptide sequence was selected from the N terminal of RABEPK. Peptide sequence MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKV. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RABEPK |
| Supplier Page | Shop |
Product images
![Western Blot: p40 (p63 delta) Antibody [NBP1-57003] - Human Liver cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/4245_p40-%2528p63-delta%2529-Antibody-Western-Blot-NBP1-57003-img0003.jpg)
Western Blot: p40 (p63 delta) Antibody [NBP1-57003] - Human Liver cell lysate, concentration 0.2-1 ug/ml.