p40 (p63 delta) Antibody

Name p40 (p63 delta) Antibody
Supplier Novus Biologicals
Catalog NBP1-57003
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Pig, Dog, Rabbit
Antigen Synthetic peptides corresponding to RABEPK (Rab9 effector protein with kelch motifs) The peptide sequence was selected from the N terminal of RABEPK. Peptide sequence MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKV.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene RABEPK
Supplier Page Shop

Product images