FAM118A Antibody

Name FAM118A Antibody
Supplier Novus Biologicals
Catalog NBP1-57051
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FAM118A (family with sequence similarity 118, member A) The peptide sequence was selected from the middle region of FAM118A. Peptide sequence EVMEVLQNLYRTKSFLFVGCGETLRDQIFQALFLYSVPNKVDLEHYMLVL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FAM118A
Conjugate Unconjugated
Supplier Page Shop

Product images