ZDHHC21 Antibody

Name ZDHHC21 Antibody
Supplier Novus Biologicals
Catalog NBP1-57049
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ZDHHC21 (zinc finger, DHHC-type containing 21) The peptide sequence was selected from the middle region of ZDHHC21. Peptide sequence ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV.
Purity/Format Immunogen affinity purified
Blocking Peptide ZDHHC21 Blocking Peptide
Description Rabbit Polyclonal
Gene ZDHHC21
Conjugate Unconjugated
Supplier Page Shop

Product images