CNTD Antibody

Name CNTD Antibody
Supplier Novus Biologicals
Catalog NBP1-57048
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CNTD1 (cyclin N-terminal domain containing 1) The peptide sequence was selected from the N terminal of CNTD1. Peptide sequence QNEQAVREASGRLGRFREPQIVEFVFLLSEQWCLEKSVSYQAVEILERFM.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CNTD1
Conjugate Unconjugated
Supplier Page Shop

Product images