| Name | PRR13 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57593 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PRR13 (proline rich 13) The peptide sequence was selected from the N terminal of PRR13. Peptide sequence MWNPNAGQPGPNPYPPNIGCPGGSNPAHPPPINPPFPPGPCPPPPGAPHG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PRR13 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |