SEC14L4 Antibody

Name SEC14L4 Antibody
Supplier Novus Biologicals
Catalog NBP1-57591
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SEC14L4(SEC14-like 4 (S. cerevisiae)) The peptide sequence was selected from the N terminal of SEC14L4. Peptide sequence MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SEC14L4
Conjugate Unconjugated
Supplier Page Shop

Product images