FAM46C Antibody

Name FAM46C Antibody
Supplier Novus Biologicals
Catalog NBP1-57697
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FAM46C(family with sequence similarity 46, member C) The peptide sequence was selected from the middle region of FAM46C. Peptide sequence LIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FAM46C
Conjugate Unconjugated
Supplier Page Shop

Product images