NXPH4 Antibody

Name NXPH4 Antibody
Supplier Novus Biologicals
Catalog NBP1-57773
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NXPH4 (neurexophilin 4) The peptide sequence was selected from the N terminal of NXPH4)(50ug). Peptide sequence MRLLPEWFLLLFGPWLLRKAVSAQIPESGRPQYLGLRPAAAGAGAPGQQL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NXPH4
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.