SLC20A2 Antibody
| Name | SLC20A2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69702 |
| Prices | $369.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC20A2(solute carrier family 20 (phosphate transporter), member 2) The peptide sequence was selected from the N terminal of SLC20A2. Peptide sequence DVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGF. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC20A2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SLC20A2 Antibody [NBP1-69702] - This Anti-SLC20A2 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4086_SLC20A2%2520Antibody-Western%2520Blot-NBP1-69702-img0001.jpg)
Western Blot: SLC20A2 Antibody [NBP1-69702] - This Anti-SLC20A2 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.