CASD1 Antibody

Name CASD1 Antibody
Supplier Novus Biologicals
Catalog NBP1-69609
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CASD1(CAS1 domain containing 1) The peptide sequence was selected from the N terminal of CASD1. Peptide sequence MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CASD1
Conjugate Unconjugated
Supplier Page Shop

Product images