htrA4 Antibody
| Name | htrA4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69684 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to HTRA4(HtrA serine peptidase 4) The peptide sequence was selected from the middle region of HTRA4 (NP_710159). Peptide sequence LKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTD. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | HTRA4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: HTRA4 Antibody [NBP1-69684] - This Anti-HTRA4 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15282_HTRA4%2520Antibody-Western%2520Blot-NBP1-69684-img0001.jpg)
Western Blot: HTRA4 Antibody [NBP1-69684] - This Anti-HTRA4 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.