SNAP29 Antibody

Name SNAP29 Antibody
Supplier Novus Biologicals
Catalog NBP1-69180
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SNAP29 (synaptosomal-associated protein, 29kDa) The peptide sequence was selected from the middle region of SNAP29. Peptide sequence QPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SNAP29
Conjugate Unconjugated
Supplier Page Shop

Product images